PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462918004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 897aa    MW: 101138 Da    PI: 6.4559
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462918004genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox40.54.7e-132072557
               SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
               t+ ++ q++ Le+++ + +yp+ e++   A+ +gLt +qV++WF+ rR ke++
  462918004 20 TKKSPLQIQMLEKFYTEVQYPKPEDMVGYATTVGLTYNQVRIWFKERRRKERR 72
               566899*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.28E-121274IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.7E-131373IPR009057Homeodomain-like
PROSITE profilePS5007114.3661373IPR001356Homeobox domain
SMARTSM003898.5E-121577IPR001356Homeobox domain
CDDcd000867.03E-72063No hitNo description
PfamPF000461.7E-102072IPR001356Homeobox domain
PfamPF156121.6E-5524553IPR028942WHIM1 domain
PfamPF156132.3E-10630701IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 897 aa     Download sequence    Send to blast
MPPAQMMVSS LGAKRENAGT KKSPLQIQML EKFYTEVQYP KPEDMVGYAT TVGLTYNQVR  60
IWFKERRRKE RREMEATGAR IERQLSSRSS GPRSSSNTSS CSQAPLSESS SISIIGEEHT  120
VRQQVLFHKD YILRKIFRKD GPPLGNEFDP LPQSAHGNIR DAMCYDSSQS RRAVNKRKIM  180
EYTDQRSTVP HEDTVPVRKH GIGKGLMTVW HAMYSHNVEC QGGSSFIDET GCLRSLRPFD  240
ASDRLEDQDN GKKIQIKSQS QSMPRQKVDK RSKTLLNKRK VPCRRVIVPK EHSRMNCHLS  300
VDKSELSERQ TELVALVDDE ELELSELQAD LLAKFPPQSV KMKQPFSMKP WDSSPEMVKK  360
LFQVARFVYT HFGSIDVHPF TFDEFVQAFH DKVREQEFDV NFWIKSLNSL TWVEILRQVL  420
VASGFGSKQH MNRDFYDKIV DLNIPGTSEL EQLICSTLSS DITLFEKIAS SAYRLRVDPR  480
IKGKEDTRSD SEECGSVDDD EDASSSDDEP DGLQKINFPE HERERWLLGL MEGEYSDLSI  540
DEKLDCLVAL IDVVSGACSV PRLEGPPKVS QDAPKVQPRP SGGKIKKSTK NLYQSSDESL  600
NGPGSQRSQG HTVDSRRNDL SGIAHEPQVV LLGSDRRYNS YWLILGPCRA DDPGHRRVYF  660
ESSEDGHWEV VDSPQELLSL LSILDRRGTR EAHLLASLEK RQACLFEAMK KYLEDGNAVG  720
LAVSSDSCHS ETSGDGASPQ TSSVDGASPV SEIENTSVPT GHAVNNSDSS SAIVIEIGRS  780
DDEKILMWER LQAFDKWIWA SFYSILTAVG FDLEERYAVH VATCREPEDM SEVPNHKVLP  840
SQLQALKASI HVIEASMPEV AFVGSWKKSA HKLWVKRLRR TSSLPELLQD HTLVRGS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16572RRRKERRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0043099e-49AP004309.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0560B08.
GenBankAP0043809e-49AP004380.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0594D10.
GenBankAP0149639e-49AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankCP0126159e-49CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661208.10.0PREDICTED: uncharacterized protein LOC101768262 isoform X2
TrEMBLK4A5250.0K4A525_SETIT; Uncharacterized protein
STRINGSi033977m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45563350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.16e-89Homeodomain-like transcriptional regulator